婷婷综合在线,日本爱爱网站,一个人免费看的在线中文字幕视频 ,精品国产精品国产偷麻豆

服務(wù)熱線

15021010459
產(chǎn)品中心
當(dāng)前位置:主頁 > 產(chǎn)品中心 > 干細(xì)胞因子及添加物 > 細(xì)胞因子蛋白添加物 >Trefoil Factor-1 Human Recombinant CYT-586

Trefoil Factor-1 Human Recombinant CYT-586

簡要描述:TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.

  • 產(chǎn)品型號(hào):CYT-586
  • 廠商性質(zhì):代理商
  • 更新時(shí)間:2017-03-19
  • 訪  問  量:1785
詳細(xì)介紹

現(xiàn)貨供應(yīng),歡迎訂購:      :

Trefoil Factor-1 Human Recombinant

5ug/20ug/1mg

Catalogue NumberCYT-586
Synonyms TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
Introduction The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease.
Description TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
TFF-1 Human Recombinant is purified by proprietary chromatographic techniques.
Source Escherichia Coli.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The protein was lyophilized after dialysis against 1xPBS pH-7.4.
Solubility It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Amino acid sequence EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
PNTIDVPPEEECEF.
Biological Activity Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1,000-2,000ng/ml corresponding to a specific activity of 500-1,000IU/mg.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» TFF1 Human, His
» TFF2 Human
» TFF2 Human, His
» TFF3 Human
» TFF3 Human, His

 

Related Products

Activin A  cyt-569     Hystemcell.cn  Recombinant Human Activin-A

Activin A Plant-Active       cyt-414     Hystemcell.cn  Recombinant Human Activin-A Active

Activin A HEK-Active         cyt-078     Hystemcell.cn  Recombinant Human  Activin-A HEK-Active

Activin A Plant cyt-052     Hystemcell.cn  Recombinant Human Activin-A, Plant

Activin B Active        cyt-057     Hystemcell.cn  Recombinant Human Activin-B Active

Activin B          cyt-058     Hystemcell.cn  Recombinant Human Activin-B

Activin A, Active       cyt-145     Hystemcell.cn  Recombinant Human Activin-A, Active

mActivin A        cyt-146     Hystemcell.cn  Recombinant Mouse Activin-A

rActivin A cyt-147     Hystemcell.cn  Recombinant Rat Activin-A

Acrp30  cyt-024     Human Adiponectin

Acrp30  cyt-280     Hystemcell.cn  Recombinant Human Adiponectin

Acrp30 His        cyt-433     Hystemcell.cn  Recombinant Human Adiponectin, His tag

mAcrp30 His    cyt-537     Hystemcell.cn  Recombinant Mouse Adiponectin, His tag

Acrp30 HEK      cyt-434     Hystemcell.cn  Recombinant Human Adiponectin glycosilated, HEK

mAcrp30 HEK  cyt-435     Hystemcell.cn  Recombinant Mouse Adiponectin glycosilated, HEK

pAcrp30 HEK    cyt-696     Hystemcell.cn  Recombinant Porcine Adiponectin glycosilated, HEK

Acrp30 Tri         cyt-233     Hystemcell.cn  Recombinant Human Adiponectin Trimeric Form

mAcrp30 Tri     cyt-247     Hystemcell.cn  Recombinant Mouse Adiponectin Trimeric Form

gAcrp30   cyt-615     Hystemcell.cn  Recombinant Human Adiponectin Globular

gAcrp30 His     cyt-277     Hystemcell.cn  Recombinant Human Adiponectin Globular, His tag

mgAcrp30         cyt-432     Hystemcell.cn  Recombinant Mouse Adiponectin Globular

AIF1 cyt-697     Hystemcell.cn  Recombinant Human Allograft Inflammatory Factor 1

AIF1L        cyt-007     Hystemcell.cn  Recombinant Human Allograft Inflammatory Factor 1 Like

AITRL      cyt-076     Hystemcell.cn  Recombinant Human AITRL

AITRL His cyt-317     Hystemcell.cn  Recombinant Human AITRL, His Tag

ANGPT1   cyt-074     Hystemcell.cn  Recombinant Human Angiopoietin-1

ANGPTL3 cyt-248     Hystemcell.cn  Recombinant Human Angiopoietin-like Protein 3

ANGPTL4 cyt-249     Hystemcell.cn  Recombinant Human Angiopoietin-like Protein 4

ANGPTL4 HEK  cyt-698     Hystemcell.cn  Recombinant Human Angiopoietin-like Protein 4, HEK

APOA1      cyt-661     Hystemcell.cn  Recombinant Human Apolipoprotein A-I

APOA1      cyt-037     Human Apolipoprotein A-I

APOA2      cyt-038     Human Apolipoprotein A-II

APOA5      cyt-025     Hystemcell.cn  Recombinant Human Apolipoprotein A-V

AREG        cyt-041     Hystemcell.cn  Recombinant Human Amphiregulin

Clusterin  cyt-278     Hystemcell.cn  Recombinant Human Apoliprotein-J

Clusterin  cyt-548     Human Apoliprotein-J

rClusterin         cyt-437     Hystemcell.cn  Recombinant Rat Apoliprotein-J

k9Clusterin       cyt-549     Hystemcell.cn  Recombinant Canine Apoliprotein-J

k9Clusterin HEK       cyt-618     Hystemcell.cn  Recombinant Canine Apoliprotein-J HEK

APO D       cyt-547     Hystemcell.cn  Recombinant Human Apoliprotein-D

APO D GST        cyt-652     Hystemcell.cn  Recombinant Human APO-D GST Tag

APOH        cyt-189     Hystemcell.cn  Recombinant Human Apoliprotein-H

APOM       cyt-715     Hystemcell.cn  Recombinant Human Apolipoprotein-M

APOM HEK       cyt-026     Hystemcell.cn  Recombinant Human Apolipoprotein-M, HEK

Artemin   cyt-306     Hystemcell.cn  Recombinant Human Artemin

BD 1          cyt-564     Hystemcell.cn  Recombinant Human Beta Defensin -1

mBD 1      cyt-044     Hystemcell.cn  Recombinant Mouse Beta Defensin -1

rBD 1        cyt-062     Hystemcell.cn  Recombinant Rat Beta Defensin -1

BD 2          cyt-571     Hystemcell.cn  Recombinant Human Beta Defensin -2

mBD 2      cyt-035     Hystemcell.cn  Recombinant Mouse Beta Defensin -2

BD 3          cyt-461     Hystemcell.cn  Recombinant Human Beta Defensin -3

mBD 3      cyt-036     Hystemcell.cn  Recombinant Mouse Beta Defensin -3

rBD 3        cyt-063     Hystemcell.cn  Recombinant Rat Beta Defensin -3

BD 4          cyt-599     Hystemcell.cn  Recombinant Human Beta Defensin -4

rBD 4        cyt-066     Hystemcell.cn  Recombinant Rat Beta Defensin -4

BDNF        cyt-207     Hystemcell.cn  Recombinant Human Brain-Derived Neurotrophic Factor

proBDNF  cyt-014     Hystemcell.cn  Recombinant Human Precursor Brain-Derived Neurotrophic Factor

BAFF         cyt-307     Hystemcell.cn  Recombinant Human BAFF (BLyS)

BAFF His  cyt-545     Hystemcell.cn  Recombinant Human BAFF (BLyS), His Tag

BAFF Plant        cyt-054     Hystemcell.cn  Recombinant Human BAFF (BLyS), Plant

BAFF R      cyt-429     Hystemcell.cn  Recombinant Human BAFF (BLyS) Receptor

BMPR1A  cyt-380     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein Receptor-1A

BMPR1A HEK   cyt-713     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein Receptor-1A HEK

BMP 2      cyt-261     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-2

BMP 2 HEK       cyt-080     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-2, HEK

BMP 2 Mono    cyt-627     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-2 Monomer

Pro BMP 2        cyt-427     Hystemcell.cn  Recombinant Human Pro Bone Morphogenetic protein-2

BMP 4      cyt-361     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-4

BMP 4 Active   cyt-081     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-4 Active

BMP 5      cyt-660     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-5

BMP 7      cyt-333     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-7

BMP 7 His         cyt-629     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-7 His Tag

BMP 7 CHO      cyt-276     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-7, CHO

BMP 7 Plant     cyt-039     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-7, Plant

BMP 7 HEK       cyt-082     Hystemcell.cn  Recombinant Human Bone Morphogenetic protein-7, HEK

b NGF      cyt-579     Hystemcell.cn  Recombinant Human beta Nerve Growth Factor

b NGF CHO       cyt-246     Hystemcell.cn  Recombinant Human beta Nerve Growth Factor, CHO

b NGF HEK        cyt-079     Hystemcell.cn  Recombinant Human beta Nerve Growth Factor, HEK

mb NGF    cyt-581     Hystemcell.cn  Recombinant Mouse beta Nerve Growth Factor

mb NGF    cyt-440     Mouse beta Nerve Growth Factor

ProNGF    cyt-426     Hystemcell.cn  Recombinant Human Pro-Nerve Growth Factor

BNP cyt-327     Hystemcell.cn  Recombinant Human B-type Natriuretic Protein

BNP His    cyt-605     Hystemcell.cn  Recombinant Human B-type Natriuretic Protein His Tag

BNP cyt-369     Human B-type Natriuretic Protein

BST2         cyt-059     Hystemcell.cn  Recombinant Human Bone Marrow Stromal Cell Antigen 2

BTC  cyt-330     Hystemcell.cn  Recombinant Human Betacellulin

BTC His    cyt-077     Hystemcell.cn  Recombinant Human Betacellulin, His Tag

mBTC       cyt-131     Hystemcell.cn  Recombinant Mouse Betacellulin

bBTC         cyt-406     Hystemcell.cn  Recombinant Bovine Betacellulin

CDNF        cyt-167     Hystemcell.cn  Recombinant Human Cerebral Dopamine Neurotrophic Factor

mCDNF    cyt-729     Hystemcell.cn  Recombinant Mouse Cerebral Dopamine Neurotrophic Factor

rCDNF      cyt-730     Hystemcell.cn  Recombinant Rat Cerebral Dopamine Neurotrophic Factor

CLCF1       cyt-071     Hystemcell.cn  Recombinant Human Cardiotrophin-Like Cytokine Factor 1

CNTF         cyt-272     Hystemcell.cn  Recombinant Human Ciliary Neurotrophic Factor

CNTF His  cyt-573     Hystemcell.cn  Recombinant Human Ciliary Neurotrophic Factor, His Tag

mCNTF     cyt-139     Hystemcell.cn  Recombinant Mouse Ciliary Neurotrophic Factor

rCNTF       cyt-654     Hystemcell.cn  Recombinant Rat Ciliary Neurotrophic Factor

CT 1 cyt-436     Hystemcell.cn  Recombinant Human Cardiotrophin-1

mCT 1       cyt-151     Hystemcell.cn  Recombinant Mouse Cardiotrophin-1

rCT 1         cyt-199     Hystemcell.cn  Recombinant Rat Cardiotrophin-1

CTGF         cyt-541     Hystemcell.cn  Recombinant Human Connective Tissue Growth Factor

CTGF His  cyt-438     Hystemcell.cn  Recombinant Human Connective Tissue Growth Factor, His Tag

CTGF (182-250 a.a.)         cyt-526     Hystemcell.cn  Recombinant Human Connective Tissue Growth Factor 182-250 a.a.

CTGF HEK         cyt-687     Hystemcell.cn  Recombinant Human Connective Tissue Growth Factor, HEK

CTLA 4      cyt-366     Hystemcell.cn  Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4

CYR61      cyt-164     Hystemcell.cn  Recombinant Human Cysteine-Rich Angiogenic Inducer 61

EBI3 cyt-367     Hystemcell.cn  Recombinant Human Epstein Barr Virus Induced 3

EBI3 His   cyt-668     Hystemcell.cn  Recombinant Human Epstein Barr Virus Induced 3, His Tag

mEBI3      cyt-621     Hystemcell.cn  Recombinant Mouse Epstein Barr Virus Induced 3

EG VEGF  cyt-338     Hystemcell.cn  Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor

EGF  cyt-217     Hystemcell.cn  Recombinant Human Epidermal Growth Factor

EGF Pichia         cyt-332     Hystemcell.cn  Recombinant Human Epidermal Growth Factor, Pichia

EGF (Leu 21)     cyt-466     Hystemcell.cn  Recombinant Human Epidermal Growth Factor 21-Leu

mEGF        cyt-326     Hystemcell.cn  Recombinant Mouse Epidermal Growth Factor

mEGF        cyt-554     Mouse Epidermal Growth Factor

mEGF, His         cyt-138     Hystemcell.cn  Recombinant Mouse Epidermal Growth Factor, His

rEGF          cyt-556     Rat Epidermal Growth Factor

rEGF          cyt-669     Hystemcell.cn  Recombinant Rat Epidermal Growth Factor

EMAP II    cyt-607     Hystemcell.cn  Recombinant Human Endothelial-Monocyte Activating Polypeptide II

AIMP1      cyt-021     Hystemcell.cn  Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1

Endoglin Sf9     cyt-389     Hystemcell.cn  Recombinant Human Endoglin, Sf9

Endoglin   cyt-525     Hystemcell.cn  Recombinant Human Endoglin

mEndoglin        cyt-424     Hystemcell.cn  Recombinant Mouse Endoglin

EPGN        cyt-601     Hystemcell.cn  Recombinant Human Epigen

EREG        cyt-609     Hystemcell.cn  Recombinant Human Epiregulin

EPO a        cyt-201     Hystemcell.cn  Recombinant Human Erythropoietin-alpha

EPO a Fc   cyt-325     Hystemcell.cn  Recombinant Human Erythropoietin-alpha Fc/Chimera

EPO a HEK        cyt-083     Hystemcell.cn  Recombinant Human Erythropoietin-alpha, HEK

FAS   cyt-125     Hystemcell.cn  Recombinant Human sFas Receptor

FASLG       cyt-031     Hystemcell.cn  Recombinant Human FAS Ligand

FASLG HEK        cyt-051     Hystemcell.cn  Recombinant Human FAS Ligand, HEK

FGF 1        cyt-264     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-acidic

FGF 1 Sf9  cyt-364     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-acidic, Sf9

mFGF 1     cyt-528     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-acidic

mFGF 1 His       cyt-072     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag

rFGF 1       cyt-075     Hystemcell.cn  Recombinant Rat Fibroblast Growth Factor-acidic

baFGF       cyt-613     Bovine Fibroblast Growth Factor-acidic

FGF 2        cyt-218     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-basic

FGF 2 Sf9  cyt-365     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-basic, Sf9

FGF 2 (147 a.a.)        cyt-557     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-basic (147 a.a)

FGF 2 293 Cells         cyt-085     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-basic, 293 Cells

FGF2 Plant        cyt-123     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-basic, Plant

bFGF 2      cyt-288     Hystemcell.cn  Recombinant Bovine Fibroblast Growth Factor-basic

bFGF 2      cyt-560     Bovine Fibroblast Growth Factor-basic

mFGF 2     cyt-386     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-basic

rFGF 2       cyt-608     Hystemcell.cn  Recombinant Rat Fibroblast Growth Factor-basic

FGF 4        cyt-312     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-4

FGF 4 HEK         cyt-084     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-4, HEK

FGF 8        cyt-714     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-8

mFGF 8     cyt-070     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-8

FGF 8 HEK         cyt-087     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-8, HEK

FGF 9        cyt-415     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-9

mFGF 9     cyt-349     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-9

rFGF 9       cyt-558     Hystemcell.cn  Recombinant Rat Fibroblast Growth Factor-9

FGF12       cyt-620     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor 12

FGF13       cyt-121     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor 13

mFGF-15  cyt-027     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-15

FGF-18      cyt-120     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-18

mFGF-18  cyt-064     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-18

rFGF-18    cyt-176     Hystemcell.cn  Recombinant Rat Fibroblast Growth Factor-18

FGF 19     cyt-700     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-19

FGF 19 His        cyt-279     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-19 His Tag

FGF 21      cyt-474     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-21

FGF 21 His        cyt-281     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-21, His Tag

mFGF 21  cyt-339     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-21

mFGF 21 His     cyt-516     Hystemcell.cn  Recombinant Mouse Fibroblast Growth Factor-21, His Tag

rFGF 21    cyt-130     Hystemcell.cn  Recombinant Rat Fibroblast Growth Factor-21

bFGF 21    cyt-657     Hystemcell.cn  Recombinant Bovine Fibroblast Growth Factor-21

FGF 22      cyt-428     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-22

FGF 23      cyt-020     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-23

FGF 23 His        cyt-374     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-23 His Tag

FGF 23 C-term cyt-028     Hystemcell.cn  Recombinant Human Fibroblast Growth Factor-23 C-Terminal

Flt3 Ligand        cyt-331     Hystemcell.cn  Recombinant Human Flt3-Ligand

Flt3 Ligand HEK        cyt-706     Hystemcell.cn  Recombinant Human Flt3-Ligand, HEK

Flt3 Ligand Sf9 cyt-409     Hystemcell.cn  Recombinant Human Flt3-Ligand, Sf9

mFlt3 Ligand    cyt-340     Hystemcell.cn  Recombinant Mouse Flt3-Ligand

rmFlt3 Ligand  cyt-157     Hystemcell.cn  Recombinant Rhesus Macaque Flt3-Ligand

FST   cyt-232     Hystemcell.cn  Recombinant Human Follistatin

FST His     cyt-029     Hystemcell.cn  Recombinant Human Follistatin His Tag

mFST         cyt-124     Hystemcell.cn  Recombinant Mouse Follistatin

HB-EGF    cyt-119     Hystemcell.cn  Recombinant Human Proheparin-Binding EGF-like Growth Factor

mHB-EGF cyt-068     Hystemcell.cn  Recombinant Mouse Proheparin-Binding EGF-like Growth Factor

rHB-EGF   cyt-170     Hystemcell.cn  Recombinant Rat Proheparin-Binding EGF-like Growth Factor

LGALS1     cyt-544     Hystemcell.cn  Recombinant Human Galectin-1

mLGALS1 cyt-186     Hystemcell.cn  Recombinant Mouse Galectin-1

LGALS2     cyt-725     Hystemcell.cn  Recombinant Human Galectin-2

mLGALS2 cyt-019     Hystemcell.cn  Recombinant Mouse Galectin-2

LGALS3     cyt-606     Hystemcell.cn  Recombinant Human Galectin-3

LGALS3 His       cyt-693     Hystemcell.cn  Recombinant Human Galectin-3 His Tag

mLGALS3 cyt-188     Hystemcell.cn  Recombinant Mouse Galectin-3

LGALS4     cyt-686     Hystemcell.cn  Recombinant Human Galectin-4

mLGALS4 cyt-187     Hystemcell.cn  Recombinant Mouse Galectin-4

LGALS7   cyt-016     Hystemcell.cn  Recombinant Human Galectin-7

LGALS7 His       cyt-617     Hystemcell.cn  Recombinant Human Galectin-7 His Tag

mLGALS7 cyt-184     Hystemcell.cn  Recombinant Mouse Galectin-7

LGALS8   cyt-017     Hystemcell.cn  Recombinant Human Galectin-8

LGALS8 His       cyt-727     Hystemcell.cn  Recombinant Human Galectin-8, His Tag

mLGALS8         cyt-185     Hystemcell.cn  Recombinant Mouse Galectin-8

LGALS9     cyt-708     Hystemcell.cn  Recombinant Human Galectin-9

mLGALS9 cyt-550     Hystemcell.cn  Recombinant Mouse Galectin-9

LGALS13  cyt-004     Hystemcell.cn  Recombinant Human Galectin-13

LGALS14  cyt-003     Hystemcell.cn  Recombinant Human Galectin-14

LGALSL     cyt-073     Hystemcell.cn  Recombinant Human Galectin-Related Protein

GDNF        cyt-305     Hystemcell.cn  Recombinant Human Glial-Derived Neurotrophic Factor

GDF3        cyt-694     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 3

GDF5        cyt-442     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 5

GDF5 His cyt-653     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 5 His Tag

GDF10      cyt-659     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 10

GDF15 His        cyt-691     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 15, His Tag

GDF15 D  cyt-314     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 15 D-Vairant

GDF15     cyt-335     Hystemcell.cn  Recombinant Human Growth and Differentiation factor 15

G CSF        cyt-220     Hystemcell.cn  Recombinant Human Granulocyte-Colony Stimulating Factor

G CSF His cyt-476     Hystemcell.cn  Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag

G CSF CHO        cyt-329     Hystemcell.cn  Recombinant Human Granulocyte-Colony Stimulating Factor, CHO

G CSF PEG         cyt-018     Hystemcell.cn  Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor

G CSF HEK         cyt-088     Hystemcell.cn  Recombinant Human Granulocyte-Colony Stimulating Factor, HEK

mG CSF    cyt-410     Hystemcell.cn  Recombinant Mouse Granulocyte-Colony Stimulating Factor

GH   cyt-202     Hystemcell.cn  Recombinant Human Growth Hormone

pGH 22kDa       cyt-235     Hystemcell.cn  Recombinant Human Placental Corr Growth Hormone

GH 20kDa         cyt-259     Hystemcell.cn  Recombinant Human Pituitary Growth Hormone 20kDa

pGH 20kDa       cyt-337     Hystemcell.cn  Recombinant Human Placental Growth Hormone 20kDa

GH Plant  cyt-053     Hystemcell.cn  Recombinant Human Growth Hormone, Plant

GH HEK    cyt-091     Hystemcell.cn  Recombinant Human Growth Hormone, HEK

GHBP        cyt-238     Hystemcell.cn  Recombinant Human Growth Hormone Binding Protein

oGHBP     cyt-470     Hystemcell.cn  Recombinant Ovine Growth Hormone Binding Protein

bGHBP     cyt-471     Hystemcell.cn  Recombinant Bovine Growth Hormone Binding Protein

raGHBP    cyt-593     Hystemcell.cn  Recombinant Rabbit Growth Hormone Binding Protein

chGH        cyt-430     Hystemcell.cn  Recombinant Chicken Growth Hormone

oGH cyt-237     Hystemcell.cn  Recombinant Ovine Growth Hormone

oGH Placental cyt-594     Hystemcell.cn  Recombinant Placental Ovine Growth Hormone

bGH cyt-636     Hystemcell.cn  Recombinant Bovine Growth Hormone

mGH         cyt-540     Hystemcell.cn  Recombinant Mouse Growth Hormone

rGH  cyt-296     Hystemcell.cn  Recombinant Rat Growth Hormone

cGH cyt-297     Hystemcell.cn  Recombinant Carp Growth Hormone

dGH cyt-498     Hystemcell.cn  Recombinant Denis Growth Hormone

maiGH      cyt-499     Hystemcell.cn  Recombinant Mai Mai Growth Hormone

sGH cyt-529     Hystemcell.cn  Recombinant Gilthead Seabream Growth Hormone

raGH         cyt-514     Hystemcell.cn  Recombinant Rabbit Growth Hormone

pGH cyt-519     Hystemcell.cn  Recombinant Porcine Growth Hormone

chGH Antagonist     cyt-538     Hystemcell.cn  Recombinant Chicken Growth Hormone Anatagonist

oGH Antagonist       cyt-215     Hystemcell.cn  Recombinant Ovine Growth Hormone Anatagonist

zGH         cyt-710     Hystemcell.cn  Recombinant Zebrafish Growth Hormone

zGH Mutant     cyt-709     Hystemcell.cn  Recombinant Zebrafish Growth Hormone Mutant

GM CSF    cyt-221     Hystemcell.cn  Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor

GM CSF Pichia cyt-324     Hystemcell.cn  Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia

GM CSF Sf9       cyt-416     Hystemcell.cn  Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9

GM CSF HEK     cyt-089     Hystemcell.cn  Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK

GM CSF His      cyt-477     Hystemcell.cn  Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag

PIXY321   cyt-360     Hystemcell.cn  Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321)

mGM CSF        cyt-222     Hystemcell.cn  Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor

rGM CSF          cyt-395     Hystemcell.cn  Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor

pGM CSF          cyt-401     Hystemcell.cn  Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor

rmGM CSF        cyt-720     Hystemcell.cn  Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor

k9GM CSF         cyt-724     Hystemcell.cn  Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor

GMF b      cyt-565     Hystemcell.cn  Recombinant Human Glia Maturation Factor Beta

GMF b His         cyt-726     Hystemcell.cn  Recombinant Human Glia Maturation Factor Beta His Tag

mGMF b   cyt-006     Hystemcell.cn  Recombinant Mouse Glia Maturation Factor Beta

rGMF b     cyt-049     Hystemcell.cn  Recombinant Rat Glia Maturation Factor Beta

GMFG       cyt-632     Hystemcell.cn  Recombinant Human Glia Maturation Factor Gamma

HDGF        cyt-681     Hystemcell.cn  Recombinant Human Hepatoma-Derived Growth Factor

HDGF2     cyt-132     Hystemcell.cn  Recombinant Human Hepatoma-Derived Growth Factor-2

HGF CHO cyt-251     Hystemcell.cn  Recombinant Human Hepatocyte Growth Factor, CHO

HGF Sf9    cyt-244     Hystemcell.cn  Recombinant Human Hepatocyte Growth Factor, Sf9

HGF HEK  cyt-090     Hystemcell.cn  Recombinant Human Hepatocyte Growth Factor, HEK

HGF-A       cyt-664     Hystemcell.cn  Recombinant Human Hepatocyte Growth Factor A Chain

HGF-B       cyt-665     Hystemcell.cn  Recombinant Human Hepatocyte Growth Factor B Chain

pHGF        cyt-522     Porcine Hepatocyte Promoting Growth Factor

IFI30         cyt-183     Hystemcell.cn  Recombinant Human Interferon Gamma-Inducible protein 30

IFN a 1      cyt-291     Hystemcell.cn  Recombinant Human Interferon-alpha 1

IFN a 1a   cyt-520     Hystemcell.cn  Recombinant Human Interferon-alpha 1a

IFN a 1b   cyt-283     Hystemcell.cn  Recombinant Human Interferon-alpha 1b

IFN a 2a   cyt-204     Hystemcell.cn  Recombinant Human Interferon-alpha 2a

IFN a 2a Plant  cyt-543     Hystemcell.cn  Recombinant Human Interferon-alpha 2a, Tobacco

IFN a 2b   cyt-205     Hystemcell.cn  Recombinant Human Interferon-alpha 2b

IFN a 2b Yeast cyt-460     Hystemcell.cn  Recombinant Human Interferon-alpha 2b, Saccharomyces

IFN a 2b 20kd-PEG   cyt-034     Hystemcell.cn  Recombinant Human Interferon-alpha 2b 20kd-Pegylated

IFN a 2b HEK    cyt-092     Hystemcell.cn  Recombinant Human Interferon-alpha 2b, HEK

IFN a 2a HEK    cyt-093     Hystemcell.cn  Recombinant Human Interferon-alpha 2a, HEK

IFNA7       cyt-196     Hystemcell.cn  Recombinant Human Interferon-alpha 7

IFNA14     cyt-135     Hystemcell.cn  Recombinant Human Interferon-alpha 14

IFN b 1a   cyt-236     Hystemcell.cn  Recombinant Human Interferon-beta 1a

IFN b 1b   cyt-234     Hystemcell.cn  Recombinant Human Interferon-beta 1b

mIFN b His        cyt-651     Hystemcell.cn  Recombinant Mouse Interferon-beta His Tag

IFN g         cyt-206     Hystemcell.cn  Recombinant Human Interferon-gamma

IFN g His  cyt-478     Hystemcell.cn  Recombinant Human Interferon-gamma His Tag

mIFN g     cyt-358     Hystemcell.cn  Recombinant Mouse Interferon-gamma

rIFN g       cyt-359     Hystemcell.cn  Recombinant Rat Interferon-gamma

pIFN g       cyt-402     Hystemcell.cn  Recombinant Porcine Interferon-gamma

qIFN g       cyt-739     Hystemcell.cn  Recombinant Equine Interferon-gamma

IFNW1      cyt-040     Hystemcell.cn  Recombinant Human Interferon-Omega 1

oIFN tau   cyt-377     Hystemcell.cn  Recombinant Ovine Interferon-Tau

IRF 1         cyt-449     Hystemcell.cn  Recombinant Human Interferon Regulatory Factor-1

IRF 2         cyt-534     Hystemcell.cn  Recombinant Human Interferon Regulatory Factor-2

IRF 3         cyt-292     Hystemcell.cn  Recombinant Human Interferon Regulatory Factor-3

IGF1 cyt-216     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor-1

IGF1 GST  cyt-690     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor-1, GST-Tag

IGF1 Des1-3     cyt-518     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor-1 Des (1-3)

Long R3 IGF1   cyt-022     Hystemcell.cn  Recombinant Human LR3 Insulin Like Growth Factor-1

IGF1 N15 cyt-128     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor-1 N15 Labeled

mIGF1      cyt-229     Hystemcell.cn  Recombinant Mouse Insulin Like Growth Factor-1

rIGF1        cyt-289     Hystemcell.cn  Recombinant Rat Insulin Like Growth Factor-1

sIGF1        cyt-295     Hystemcell.cn  Recombinant Gilthead Seabream Insulin Like Growth Factor-1

IGF2 cyt-265     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor-2

pro-IGF2  cyt-110     Hystemcell.cn  Recombinant Human Pro-Insulin Like Growth Factor-2

IGFBP 1    cyt-299     Human Insulin Like Growth Factor Binding Protein-1

IGFBP 3    cyt-300     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor Binding Protein-3

IGFBP 4    cyt-030     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor Binding Protein-4

IGFBP 5    cyt-464     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor Binding Protein-5

IGFBP 6    cyt-258     Hystemcell.cn  Recombinant Human Insulin Like Growth Factor Binding Protein-6

IHH  cyt-195     Hystemcell.cn  Recombinant Human Indian Hedgehog

IL 1 alpha cyt-253     Hystemcell.cn  Recombinant Human Interleukin-1 alpha

IL 1 alpha His   cyt-479     Hystemcell.cn  Recombinant Human Interleukin-1 alpha, His Tag

mIL 1 alpha      cyt-523     Hystemcell.cn  Recombinant Mouse Interleukin-1 alpha

rIL 1 alpha        cyt-381     Hystemcell.cn  Recombinant Rat Interleukin-1 alpha

pIL 1 alpha        cyt-396     Hystemcell.cn  Recombinant Porcine Interleukin-1 alpha

IL 1 beta  cyt-208     Hystemcell.cn  Recombinant Human Interleukin-1 beta

IL 1 beta His     cyt-480     Hystemcell.cn  Recombinant Human Interleukin-1 beta, His Tag

IL 1 beta HEK   cyt-094     Hystemcell.cn  Recombinant Human Interleukin-1 beta, HEK

mIL 1 beta        cyt-273     Hystemcell.cn  Recombinant Mouse Interleukin-1 beta

mIL 1 beta His cyt-578     Hystemcell.cn  Recombinant Mouse Interleukin-1 beta, His Tag

rIL 1 beta cyt-394     Hystemcell.cn  Recombinant Rat Interleukin-1 beta

pIL 1 beta         cyt-400     Hystemcell.cn  Recombinant Porcine Interleukin-1 beta

rmIL 1 beta      cyt-718     Hystemcell.cn  Recombinant Rhesus Macaque Interleukin-1 beta

IL 1RA       cyt-203     Hystemcell.cn  Recombinant Human Interleukin-1 Receptor Antagonist

IL 1RA His         cyt-481     Hystemcell.cn  Recombinant Human Interleukin-1 Receptor Antagonist, His Tag

IL1RL1      cyt-671     Hystemcell.cn  Recombinant Human Interleukin-1 Receptor Like-1

mIL 1RA   cyt-658     Hystemcell.cn  Recombinant Mouse Interleukin-1 Receptor Antagonist

mIL 1RA His     cyt-136     Hystemcell.cn  Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag

rIL 1RA     cyt-152     Hystemcell.cn  Recombinant Rat Interleukin-1 Receptor Antagonist

hIL 1RA    cyt-010     Hystemcell.cn  Recombinant Horse Interleukin-1 Receptor Antagonist

IL 2   cyt-209     Hystemcell.cn  Recombinant Human Interleukin-2

IL 2 His     cyt-666     Hystemcell.cn  Recombinant Human Interleukin-2 His Tag

IL 2 HEK   cyt-095     Hystemcell.cn  Recombinant Human Interleukin 2, HEK

mIL 2        cyt-370     Hystemcell.cn  Recombinant Mouse Interleukin-2

mIL 2 His cyt-624     Hystemcell.cn  Recombinant Mouse Interleukin-2, His Tag

rIL 2 cyt-382     Hystemcell.cn  Recombinant Rat Interleukin-2

pIL 2          cyt-397     Hystemcell.cn  Recombinant Porcine Interleukin-2

qIL2 cyt-738     Hystemcell.cn  Recombinant Equine Interleukin-2

sIL 2R       cyt-285     Hystemcell.cn  Recombinant Human Soluble Iinterleukin-2 Receptor alpha

IL 3           cyt-210     Hystemcell.cn  Recombinant Human Interleukin-3

IL 3 His     cyt-482     Hystemcell.cn  Recombinant Human Interleukin-3, His Tag

IL 3 HEK   cyt-096     Hystemcell.cn  Recombinant Human Interleukin 3, HEK

mIL 3       cyt-371     Hystemcell.cn  Recombinant Mouse Interleukin-3

rIL 3         cyt-383     Hystemcell.cn  Recombinant Rat Interleukin-3

IL 3 Sf9     cyt-417     Hystemcell.cn  Recombinant Human Interleukin-3, Sf9

k9 IL 3       cyt-722     Hystemcell.cn  Recombinant Canine Interleukin-3

rmIL3        cyt-156     Hystemcell.cn  Recombinant Rhesus Macaque Interleukin-3

IL 4   cyt-211     Hystemcell.cn  Recombinant Human Interleukin-4

IL 4 CHO  cyt-271     Hystemcell.cn  Recombinant Human Interleukin-4 CHO

IL 4 His     cyt-483     Hystemcell.cn  Recombinant Human Interleukin-4, His Tag

IL 4 HEK   cyt-097     Hystemcell.cn  Recombinant Human Interleukin 4, HEK

mIL 4        cyt-282     Hystemcell.cn  Recombinant Mouse Interleukin-4

rIL 4 cyt-385     Hystemcell.cn  Recombinant Rat Interleukin-4

pIL 4          cyt-398     Hystemcell.cn  Recombinant Porcine Interleukin-4

rmIL4        cyt-172     Hystemcell.cn  Recombinant Rhesus Macaque Interleukin-4

IL 5           cyt-212     Hystemcell.cn  Recombinant Human Interleukin-5

mIL 5       cyt-689     Hystemcell.cn  Recombinant Mouse Interleukin-5

rIL 5 cyt-387     Hystemcell.cn  Recombinant Rat Interleukin-5

IL 6   cyt-213     Hystemcell.cn  Recombinant Human Interleukin-6

IL 6 CHO  cyt-274     Hystemcell.cn  Recombinant Human Interleukin-6, CHO

IL 6 His     cyt-484     Hystemcell.cn  Recombinant Human Interleukin-6, His Tag

IL 6 HEK   cyt-098     Hystemcell.cn  Recombinant Human Interleukin 6, HEK

mIL 6        cyt-350     Hystemcell.cn  Recombinant Mouse Interleukin-6

rIL 6 cyt-388     Hystemcell.cn  Recombinant Rat Interleukin-6

pIL 6          cyt-399     Hystemcell.cn  Recombinant Porcine Interleukin-6

rmIL 6       cyt-174     Hystemcell.cn  Recombinant Rhesus Macaque Interleukin-6

sIL 6R       cyt-286     Hystemcell.cn  Recombinant Human Soluble IL-6 Receptor alpha

IL 7   cyt-254     Hystemcell.cn  Recombinant Human Interleukin-7

IL 7 Yeast cyt-298     Hystemcell.cn  Recombinant Human Interleukin-7, Saccharomyces

IL 7 His     cyt-485     Hystemcell.cn  Recombinant Human Interleukin-7, His Tag

IL 7, HEK  cyt-197     Hystemcell.cn  Recombinant Human Interleukin-7, HEK

mIL 7        cyt-372     Hystemcell.cn  Recombinant Mouse Interleukin-7

rIL 7 cyt-163     Hystemcell.cn  Recombinant Rat Interleukin-7

IL 9   cyt-348     Hystemcell.cn  Recombinant Human  Interleukin-9

IL 9 HEK   cyt-099     Hystemcell.cn  Recombinant Human Interleukin 9, HEK

mIL 9        cyt-373     Hystemcell.cn  Recombinant Mouse Interleukin-9

rIL 9 cyt-748     Hystemcell.cn  Recombinant Rat Interleukin-9

IL 10          cyt-500     Hystemcell.cn  Recombinant Human Interleukin-10

IL 10 His   cyt-486     Hystemcell.cn  Recombinant Human Interleukin-10, His Tag

IL 10 HEK cyt-100     Hystemcell.cn  Recombinant Human Interleukin 10, HEK

mIL 10      cyt-497     Hystemcell.cn  Recombinant Mouse Interleukin-10

rIL 10        cyt-465     Hystemcell.cn  Recombinant Rat Interleukin-10

pIL 10       cyt-404     Hystemcell.cn  Recombinant Porcine Interleukin-10

IL 11          cyt-214     Hystemcell.cn  Recombinant Human Interleukin-11

IL 11 Pichia       cyt-013     Hystemcell.cn  Recombinant Human Interleukin-11, Pichia

mIL 11      cyt-646     Hystemcell.cn  Recombinant Mouse Interleukin-11

IL 12          cyt-101     Hystemcell.cn  Recombinant Human Interleukin 12

IL 12 p35 His    cyt-487     Hystemcell.cn  Recombinant Human Interleukin-12 p35, His Tag

IL 12 p40 Baculovirus       cyt-134     Hystemcell.cn  Recombinant Human Interleukin-12 p40, Baculovirus

IL 12 p40 His    cyt-488     Hystemcell.cn  Recombinant Human Interleukin-12 p40, His Tag

IL 12 p40 Plant          cyt-056     Hystemcell.cn  Recombinant Human Interleukin-12 p40, Plant

mIL 12      cyt-144     Hystemcell.cn  Recombinant Mouse Interleukin-12

rIL 12        cyt-390     Hystemcell.cn  Recombinant Rat Interleukin-12

IL 13          cyt-446     Hystemcell.cn  Recombinant Human Interleukin-13

IL 13 Variant    cyt-682     Hystemcell.cn  Recombinant Human Interleukin-13 Variant

IL 13 His   cyt-489     Hystemcell.cn  Recombinant Human Interleukin-13, His Tag

mIL 13      cyt-375     Hystemcell.cn  Recombinant Mouse Interleukin-13

rIL 13       cyt-391     Hystemcell.cn  Recombinant Rat Interleukin-13

rIL 13 109 a.a. cyt-182     Hystemcell.cn  Recombinant Rat Interleukin-13 109 a.a.

rmIL 13    cyt-175     Hystemcell.cn  Recombinant Rhesus Macaque Interleukin-13

IL 15          cyt-230     Hystemcell.cn  Recombinant Human Interleukin-15

IL 15 His   cyt-490     Hystemcell.cn  Recombinant Human Interleukin-15, His Tag

mIL 15      cyt-344     Hystemcell.cn  Recombinant Mouse Interleukin-15

mIL 15 His        cyt-647     Hystemcell.cn  Recombinant Mouse Interleukin-15, His Tag

rIL 15        cyt-345     Hystemcell.cn  Recombinant Rat Interleukin-15

pIL 15       cyt-403     Hystemcell.cn  Recombinant Porcine Interleukin-15

IL 16, (130 a.a.)        cyt-536     Hystemcell.cn  Recombinant Human Interleukin-16, (130 a.a.)

IL 16, (121 a.a.)        cyt-142     Hystemcell.cn  Recombinant Human Interleukin-16, (121 a.a.)

IL 16 His   cyt-562     Hystemcell.cn  Recombinant Human Interleukin-16, His Tag

mIL 16      cyt-559     Hystemcell.cn  Recombinant Mouse Interleukin-16

maIL 16    cyt-153     Hystemcell.cn  Recombinant Rhesus Macaque Interleukin-16

IL 17A       cyt-250     Hystemcell.cn  Recombinant Human Interleukin-17A

IL 17A His         cyt-662     Hystemcell.cn  Recombinant Human Interleukin-17A His Tag

IL 17A HEK        cyt-102     Hystemcell.cn  Recombinant Human Interleukin 17A, HEK

IL 17E       cyt-583     Hystemcell.cn  Recombinant Human Interleukin-17E

IL 17F        cyt-587     Hystemcell.cn  Recombinant Human Interleukin-17F

IL 17F HEK        cyt-103     Hystemcell.cn  Recombinant Human Interleukin 17F, HEK

IL 17 A/F  cyt-623     Hystemcell.cn  Recombinant Human Interleukin-17 A/F Heterodimer

mIL 17      cyt-378     Hystemcell.cn  Recombinant Mouse Interleukin-17A

mIL 17E    cyt-641     Hystemcell.cn  Recombinant Mouse Interleukin-17E

mIL 17F    cyt-642     Hystemcell.cn  Recombinant Mouse Interleukin-17F

mIL 17 A/F        cyt-640     Hystemcell.cn  Recombinant Mouse Interleukin-17 A/F Heterodimer

rIL 17 A/F cyt-677     Hystemcell.cn  Recombinant Rat Interleukin-17 A/F Heterodimer

rIL 17        cyt-542     Hystemcell.cn  Recombinant Rat Interleukin-17A

rIL 17E      cyt-576     Hystemcell.cn  Recombinant Rat Interleukin-17E

rIL 17F      cyt-643     Hystemcell.cn  Recombinant Rat Interleukin-17F

IL 18          cyt-269     Hystemcell.cn  Recombinant Human Interleukin-18

IL 18 His   cyt-663     Hystemcell.cn  Recombinant Human Interleukin-18 His Tag

IL18BP      cyt-728     Hystemcell.cn  Recombinant Human Interleukin-18 Binding Protein

mIL 18      cyt-634     Hystemcell.cn  Recombinant Mouse Interleukin-18

rIL 18        cyt-376     Hystemcell.cn  Recombinant Rat Interleukin-18

IL 19          cyt-363     Hystemcell.cn  Recombinant Human Interleukin-19

mIL 19      cyt-411     Hystemcell.cn  Recombinant Mouse Interleukin-19

IL 20          cyt-347     Hystemcell.cn  Recombinant Human Interleukin-20

mIL 20      cyt-379     Hystemcell.cn  Recombinant Mouse Interleukin-20

IL 21          cyt-408     Hystemcell.cn  Recombinant Human Interleukin-21

mIL 21      cyt-684     Hystemcell.cn  Recombinant Mouse Interleukin-21

rIL 21        cyt-033     Hystemcell.cn  Recombinant Rat Interleukin-21

IL 22          cyt-328     Hystemcell.cn  Recombinant Human Interleukin-22

mIL 22      cyt-539     Hystemcell.cn  Recombinant Mouse Interleukin-22

rIL 22        cyt-173     Hystemcell.cn  Recombinant Rat Interleuikin-22

mIL 22 PEG       cyt-701     Hystemcell.cn  Recombinant Mouse Interleukin-22, Pegylated

mIL 22A   cyt-148     Hystemcell.cn  Recombinant Mouse Interleukin-22 Antagonist (E117A)

IL 23          cyt-050     Hystemcell.cn  Recombinant Human Interleukin-23

IL 23 His   cyt-067     Hystemcell.cn  Recombinant Human Interleukin-23, His Tag

IL 24          cyt-515     Hystemcell.cn  Recombinant Human Interleukin-24

IL 27          cyt-048     Hystemcell.cn  Recombinant Human Interleukin-27 p28

mIL 27      cyt-570     Hystemcell.cn  Recombinant Mouse Interleukin-27

IL 28A       cyt-602     Hystemcell.cn  Recombinant Human Interleukin-28A

IL 28A HEK        cyt-104     Hystemcell.cn  Recombinant Human Interleukin-28A, HEK

mIL 28A   cyt-741     Hystemcell.cn  Recombinant Mouse  Interleukin-28A

IL 28B       cyt-105     Hystemcell.cn  Recombinant Human Interleukin-28B

mIL 28B   cyt-732     Hystemcell.cn  Recombinant Mouse Interleukin-28B

IL 29          cyt-603     Hystemcell.cn  Recombinant Human Interleukin-29

IL 29 HEK cyt-117     Hystemcell.cn  Recombinant Human Interleukin-29, HEK

IL 31          cyt-625     Hystemcell.cn  Recombinant Human Interleukin-31

mIL 31      cyt-604     Hystemcell.cn  Recombinant Mouse Interleukin-31

IL 32A       cyt-584     Hystemcell.cn  Recombinant Human IL-32 alpha

IL 32A His Tag  cyt-648     Hystemcell.cn  Recombinant Human IL-32 alpha His Tag

IL 33          cyt-425     Hystemcell.cn  Recombinant Human Interleukin-33

IL 33 His   cyt-667     Hystemcell.cn  Recombinant Human Interleukin-33 His Tag

mIL 33      cyt-655     Hystemcell.cn  Recombinant Mouse Interleukin-33

rIL 33        cyt-150     Hystemcell.cn  Recombinant Rat Interleukin-33

IL34 cyt-042     Hystemcell.cn  Recombinant Human Interleukin-34

IL36RN     cyt-009     Hystemcell.cn  Recombinant Human  Interleukin-36 Receptor Antagonist

mIL36RN cyt-154     Hystemcell.cn  Recombinant Mouse Interleukin-36 Receptor Antagonist

IL36A        cyt-158     Hystemcell.cn  Recombinant Human Interleukin-36 Alpha

IL36A 158 a.a. cyt-179     Hystemcell.cn  Recombinant Human Interleukin-36 Alpha 158 a.a.

mIL36A    cyt-162     Hystemcell.cn  Recombinant Mouse Interleukin-36 Alpha

mIL36A 153 a.a.       cyt-181     Hystemcell.cn  Recombinant Mouse Interleukin-36 Alpha 153 a.a.

IL36B        cyt-159     Hystemcell.cn  Recombinant Human Interleukin-36 Beta

IL36B 153 a.a. cyt-180     Hystemcell.cn  Recombinant Human Interleukin-36 Beta 153 a.a

mIL36B    cyt-165     Hystemcell.cn  Recombinant Mouse Interleukin-36 Beta

IL36G        cyt-160     Hystemcell.cn  Recombinant Human Interleukin-36 Gamma

IL36G 152 a.a. cyt-161     Hystemcell.cn  Recombinant Human Interleukin-36 Gamma 152 a.a.

mIL36G    cyt-745     Hystemcell.cn  Recombinant Mouse Interleukin-36 Gamma

IL37 cyt-011     Hystemcell.cn  Recombinant Human Interleukin 37

IL1F10      cyt-012     Hystemcell.cn  Recombinant Human Interleukin 1 Family, Member 10

Insulin      cyt-270     Hystemcell.cn  Recombinant Human Insulin

Insulin Yeast    cyt-614     Hystemcell.cn  Recombinant Human Insulin Yeast

pInsulin    cyt-468     Porcine Insulin

KGF  cyt-219     Hystemcell.cn  Recombinant Human Keratinocyte Growth Factor

mKGF        cyt-721     Hystemcell.cn  Recombinant Mouse Keratinocyte Growth Factor

KGF HEK   cyt-086     Hystemcell.cn  Recombinant Human Keratinocyte Growth Factor, HEK

KGF 2        cyt-303     Hystemcell.cn  Recombinant Human Keratinocyte Growth Factor-2

KGF 2 His         cyt-129     Hystemcell.cn  Recombinant Human Keratinocyte Growth Factor-2, His Tag

mKGF 2     cyt-126     Hystemcell.cn  Recombinant Mouse Keratinocyte Growth Factor-2

rKGF cyt-127     Hystemcell.cn  Recombinant Rat Keratinocyte Growth Factor-2

Leptin       cyt-228     Hystemcell.cn  Recombinant Human Leptin

Leptin       cyt-683     Human Leptin

Leptin His         cyt-287     Hystemcell.cn  Recombinant Human Leptin, His Tag

mLeptin   cyt-351     Hystemcell.cn  Recombinant Mouse Leptin

mLeptin PEG    cyt-591     Hystemcell.cn  Recombinant Pegylated Mouse Leptin

rLeptin     cyt-227     Hystemcell.cn  Recombinant Rat Leptin

rLeptin PEG      cyt-592     Hystemcell.cn  Recombinant Pegylated Rat Leptin

oLeptin     cyt-239     Hystemcell.cn  Recombinant Ovine Leptin

oLeptin, MTS   cyt-531     Hystemcell.cn  Recombinant Ovine Leptin, MTS tag

bLeptin     cyt-502     Hystemcell.cn  Recombinant Bovine Leptin

pLeptin     cyt-503     Hystemcell.cn  Recombinant Porcine Leptin

pfLeptin   cyt-530     Hystemcell.cn  Recombinant Pufferfish Leptin

sLeptin     cyt-704     Hystemcell.cn  Recombinant Salamander Leptin

hLeptin     cyt-504     Hystemcell.cn  Recombinant Horse Leptin

chLeptin   cyt-505     Hystemcell.cn  Recombinant Chicken Leptin

dLeptin     cyt-506     Hystemcell.cn  Recombinant Dog Leptin

raLeptin   cyt-507     Hystemcell.cn  Recombinant Rabbit Leptin

Leptin tA  cyt-352     Hystemcell.cn  Recombinant Human Leptin Triple Antagonist

Leptin tA PEG  cyt-702     Hystemcell.cn  Recombinant Human Leptin Triple Antagonist, Pegylated

Leptin qA cyt-353     Hystemcell.cn  Recombinant Human Leptin Quadruple Antagonist

mLeptin tA       cyt-354     Hystemcell.cn  Recombinant Mouse Leptin Triple Antagonist

mLeptin tA PEG        cyt-566     Hystemcell.cn  Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated

rLeptin tA         cyt-355     Hystemcell.cn  Recombinant Rat Leptin Triple Antagonist

rLeptin tA PEG cyt-567     Hystemcell.cn  Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated

oLeptin tA         cyt-356     Hystemcell.cn  Recombinant Ovine Leptin Triple Antagonist

oLeptin tA PEG         cyt-703     Hystemcell.cn  Recombinant Ovine Leptin Triple Antagonist, Pegylated

oLeptin qA        cyt-357     Hystemcell.cn  Recombinant Ovine Leptin Quadruple Antagonist

Leptin Receptor       cyt-508     Hystemcell.cn  Recombinant Human Leptin Binding Domain

chLeptin Receptor   cyt-509     Hystemcell.cn  Recombinant Chicken Leptin Binding Domain

LFA 3         cyt-423     Hystemcell.cn  Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein

LIF    cyt-644     Hystemcell.cn  Recombinant Human Leukemia Inhibitory Factor

mLIF          cyt-645     Hystemcell.cn  Recombinant Mouse Leukemia Inhibitory Factor

LIF GST     cyt-001     Hystemcell.cn  Recombinant Human Leukemia Inhibitory Factor, GST tag

rLIF  cyt-731     Hystemcell.cn  Recombinant Rat Leukemia Inhibitory Factor

MANF, His        cyt-133     Hystemcell.cn  Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag

MANF       cyt-141     Hystemcell.cn  Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor

M CSF       cyt-308     Hystemcell.cn  Recombinant Human Macrophage Colony Stimulating Factor

M CSF Baculovirus   cyt-637     Hystemcell.cn  Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus

M CSF HEK        cyt-106     Hystemcell.cn  Recombinant Human Macrophage Colony Stimulating Factor, HEK

M CSF His         cyt-695     Hystemcell.cn  Recombinant Human Macrophage Colony Stimulating Factor, His Tag

mM CSF   cyt-439     Hystemcell.cn  Recombinant Mouse Macrophage Colony Stimulating Factor

rM CSF     cyt-046     Hystemcell.cn  Recombinant Rat Macrophage Colony Stimulating Factor

MIF          cyt-575     Hystemcell.cn  Recombinant Human Macrophage Migration Inhibitor Factor

MIF (Active)     cyt-596     Hystemcell.cn  Recombinant Human Macrophage Migration Inhibitor Factor

MIF His N          cyt-431     Hystemcell.cn  Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus

MIF His C cyt-521     Hystemcell.cn  Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

mMIF        cyt-744     Hystemcell.cn  Recombinant Mouse Macrophage Migration Inhibitor Factor

rMIF        cyt-193     Hystemcell.cn  Recombinant Rat Macrophage Migration Inhibitor Factor

MIA cyt-310     Hystemcell.cn  Recombinant Human Melanoma Inhibitory Activity Protein

MIA2        cyt-638     Hystemcell.cn  Recombinant Human Melanoma Inhibitory Activity Protein 2

Midkine    cyt-192     Hystemcell.cn  Recombinant Human Midkine

Midkine, His     cyt-444     Hystemcell.cn  Recombinant Human Midkine, His Tag

mMidkine         cyt-178     Hystemcell.cn  Recombinant Mouse Midkine

rMidkine  cyt-747     Hystemcell.cn  Recombinant Rat Midkine

MTPN       cyt-723     Hystemcell.cn  Recombinant Human Myotrophin

Myostatin         cyt-418     Hystemcell.cn  Recombinant Human Myostatin

Myostatin His  cyt-445     Hystemcell.cn  Recombinant Human Myostatin, His-Tag

Myostatin Propetide        cyt-448     Hystemcell.cn  Recombinant Human Myostatin Propeptide

Myostatin Plant       cyt-055     Hystemcell.cn  Recombinant Human Myostatin, Plant

NGB cyt-450     Hystemcell.cn  Recombinant Human Neuroglobin

NRG1        cyt-407     Hystemcell.cn  Recombinant Human Neuregulin-1/Heregulin-b2

NRG1 B1  cyt-733     Hystemcell.cn  Recombinant Human Neuregulin-1/Heregulin-b1

NRG1 A    cyt-736     Hystemcell.cn  Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain)

NT 3 cyt-257     Hystemcell.cn  Recombinant Human Neurotrophin-3

proNT3     cyt-015     Hystemcell.cn  Recombinant Human Precursor Neurotrophin-3

mNT 3      cyt-688     Hystemcell.cn  Recombinant Mouse Neurotrophin-3

NT 4 cyt-626     Hystemcell.cn  Recombinant Human Neurotrophin-4

Noggin     cyt-475     Hystemcell.cn  Recombinant Human Noggin

Noggin HEK      cyt-107     Hystemcell.cn  Recombinant Human Noggin, HEK

mNoggin  cyt-600     Hystemcell.cn  Recombinant Mouse Noggin

Omentin  cyt-301     Hystemcell.cn  Recombinant Human Omentin

Omentin His     cyt-551     Hystemcell.cn  Recombinant Human Omentin His Tag

Omentin 298 a.a.     cyt-061     Hystemcell.cn  Recombinant Human Omentin 298 a.a.

OPG Fc     cyt-266     Hystemcell.cn  Recombinant Human Osteoprotegerin/Fc Chimera

OPG cyt-177     Hystemcell.cn  Recombinant Human Osteoprotegerin

OPG His   cyt-290     Hystemcell.cn  Recombinant Human Osteoprotegerin, His Tag

OPG Hi-5  cyt-633     Hystemcell.cn  Recombinant Human Osteoprotegerin Hi-5

OSM          cyt-231     Hystemcell.cn  Recombinant Human Oncostatin-M

OSM (209 a.a.)         cyt-639     Hystemcell.cn  Recombinant Human Oncostatin-M  (209 a.a.)

OSM (195 a.a.)         cyt-735     Hystemcell.cn  Recombinant Human Oncostatin-M  (195 a.a.)

OSM, His cyt-060     Hystemcell.cn  Recombinant Human Oncostatin-M, His Tag

OSM HEK cyt-108     Hystemcell.cn  Recombinant Human Oncostatin-M, HEK

mOSM      cyt-168     Hystemcell.cn  Recombinant Mouse Oncostatin-M

rOSM        cyt-169     Hystemcell.cn  Recombinant Rat Oncostatin-M

OSTF1       cyt-630     Hystemcell.cn  Recombinant Human Osteoclast Stimulating Factor-1

OTOR        cyt-582     Hystemcell.cn  Recombinant Human Otoraplin

PDGF AA  cyt-341     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-AA

PDGF AA Yeast         cyt-568     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-AA, Yeast

PDGF AA HEK   cyt-109     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-AA HEK

PDGF A     cyt-491     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-A

mPDGF AA        cyt-590     Hystemcell.cn  Recombinant Mouse Plaet Derived Growth Factor-AA

PDGF AB  cyt-342     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-AB

PDGF BB          cyt-501     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-BB

PDGF B     cyt-492     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-B

mPDGF BB        cyt-412     Hystemcell.cn  Recombinant Mouse Plaet Derived Growth Factor-BB

rPDGF BB          cyt-740     Hystemcell.cn  Recombinant Rat Plaet Derived Growth Factor-BB

PDGFD     cyt-155     Hystemcell.cn  Recombinant Human Plaet Derived Growth Factor-D

PDGFRA   cyt-065     Hystemcell.cn  Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha

PEDF        cyt-580     Hystemcell.cn  Recombinant Human Pigment Epithelium-Derived Factor

PEDF His  cyt-552     Hystemcell.cn  Recombinant Human Pigment Epithelium-Derived Factor, His Tag

PEDF HEK          cyt-553     Hystemcell.cn  Recombinant Human Pigment Epithelium-Derived Factor, HEK

Periostin  cyt-452     Hystemcell.cn  Recombinant Human Periostin

PGRN        cyt-524     Hystemcell.cn  Recombinant Human Progranulin

Pleiotrophin     cyt-451     Hystemcell.cn  Recombinant Human Pleiotrophin

Pleiotrophin HEK      cyt-198     Hystemcell.cn  Recombinant Human Pleiotrophin, HEK

Placental Lactogen  cyt-656     Hystemcell.cn  Recombinant Human Placental Lactogen

bPlacental Lactogen         cyt-511     Hystemcell.cn  Recombinant Bovine Placental Lactogen

oPlacental Lactogen         cyt-512     Hystemcell.cn  Recombinant Ovine Placental Lactogen

cPlacental Lactogen         cyt-510     Hystemcell.cn  Recombinant Caprine Placental Lactogen

PLGF 1      cyt-419     Hystemcell.cn  Recombinant Human Placenta Growth Factor-1

PLGF 2      cyt-420     Hystemcell.cn  Recombinant Human Placenta Growth Factor-2

Prolactin  cyt-267     Hystemcell.cn  Recombinant Human Prolactin

Prolactin His    cyt-493     Hystemcell.cn  Recombinant Human Prolactin, His Tag

mProlactin        cyt-321     Hystemcell.cn  Recombinant Mouse Prolactin

rProlactin          cyt-322     Hystemcell.cn  Recombinant Rat Prolactin

oProlactin         cyt-240     Hystemcell.cn  Recombinant Ovine Prolactin

raProlactin       cyt-513     Hystemcell.cn  Recombinant Rabbit Prolactin

Prl R, GST          cyt-469     Hystemcell.cn  Recombinant Human Prolactin Receptor , GST Tag

Prl R cyt-595     Hystemcell.cn  Recombinant Human Prolactin Receptor

raPrl R      cyt-268     Hystemcell.cn  Recombinant Rabbit Prolactin Soluble Receptor

oPrl R        cyt-293     Hystemcell.cn  Recombinant Ovine Prolactin Soluble Receptor

bPrl R        cyt-294     Hystemcell.cn  Recombinant Bovine Prolactin Soluble Receptor

tPrl R        cyt-532     Hystemcell.cn  Recombinant Raibow Trout Prolactin Soluble Receptor

rPrl R        cyt-533     Hystemcell.cn  Recombinant Rat Prolactin Soluble Receptor

oPrl A        cyt-311     Hystemcell.cn  Recombinant Ovine Prolactin Antagonist

oPrl A Mutant  cyt-705     Hystemcell.cn  Recombinant Ovine Prolactin Antagonist, Mutant

sCD4         cyt-304     Hystemcell.cn  Recombinant Human Soluble CD4

CD4 (26-226)   cyt-313     Hystemcell.cn  Recombinant Human CD4 (26-226)

CD4 (125-202) cyt-315     Hystemcell.cn  Recombinant Human CD4 (125-202)

CD4 (203-317) cyt-316     Hystemcell.cn  Recombinant Human CD4 (203-317)

sCD40L    cyt-245     Hystemcell.cn  Recombinant Human soluble CD40 Ligand/TRAP

sCD40L His       cyt-670     Hystemcell.cn  Recombinant Human soluble CD40 Ligand/TRAP His Tag

msCD40L cyt-472     Hystemcell.cn  Recombinant Mouse soluble CD40 Ligand/TRAP

SCGB1A1 cyt-743     Hystemcell.cn  Recombinant Human Uteroglobin

mSCGB1A1       cyt-746     Hystemcell.cn  Recombinant Mouse Uteroglobin

SHH cyt-676     Hystemcell.cn  Recombinant Human Sonic HedgeHog

SHH, His  cyt-717     Hystemcell.cn  Recombinant Human Sonic HedgeHog, His Tag

mSHH       cyt-597     Hystemcell.cn  Recombinant Mouse Sonic HedgeHog

mSHH, His        cyt-711     Hystemcell.cn  Recombinant Mouse Sonic HedgeHog, His Tag

DHH          cyt-467     Hystemcell.cn  Recombinant Human Desert HedgeHog

DHH (C23II)     cyt-362     Hystemcell.cn  Recombinant Human Desert HedgeHog (C23II)

sRANKL    cyt-334     Hystemcell.cn  Recombinant Human Soluble RANK Ligand

sRANKL His      cyt-692     Hystemcell.cn  Recombinant Human Soluble RANK Ligand, His Tag

sRANKL GST     cyt-631     Hystemcell.cn  Recombinant Human Soluble RANK Ligand, GST Tag

msRANKL          cyt-320     Hystemcell.cn  Recombinant Mouse Soluble RANK Ligand

sRANK Receptor      cyt-734     Hystemcell.cn  Recombinant Human Soluble RANK Receptor

mRELM a cyt-309     Hystemcell.cn  Recombinant Mouse RELM-alpha

mRELM a His   cyt-453     Hystemcell.cn  Recombinant Mouse RELM-alpha His Tag

RELM b    cyt-454     Hystemcell.cn  Recombinant Human RELM-beta

mRELM b cyt-413     Hystemcell.cn  Recombinant Mouse RELM-beta

mRELM g cyt-455     Hystemcell.cn  Recombinant Mouse RELM-Gamma

Resistin cyt-456     Hystemcell.cn  Recombinant Human Resistin

Resistin His      cyt-256     Hystemcell.cn  Recombinant Human Resistin, His Tag

Resistin Mutant       cyt-585     Hystemcell.cn  Recombinant Human Resistin Mutant

mResistin         cyt-457     Hystemcell.cn  Recombinant Mouse Resistin

rResistin  cyt-458     Hystemcell.cn  Recombinant Rat Resistin

RBP1         cyt-122     Hystemcell.cn  Recombinant Human Retinol Binding Protein-1

RBP4         cyt-535     Hystemcell.cn  Recombinant Human Retinol Binding Protein-4

RBP4 His  cyt-555     Hystemcell.cn  Recombinant Human Retinol Binding Protein-4 His Tag

RBP5         cyt-650     Hystemcell.cn  Recombinant Human Retinol Binding Protein-5

RBP7         cyt-023     Hystemcell.cn  Recombinant Human Retinol Binding Protein-7

SAA1         cyt-675     Hystemcell.cn  Recombinant Human Serum Amyloid A (APO-SAA1)

rmSAA1    cyt-719     Hystemcell.cn  Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1)

SAA4         cyt-002     Hystemcell.cn  Recombinant Human Serum Amyloid A4

SCF   cyt-255     Hystemcell.cn  Recombinant Human Stem Cell Factor

mSCF        cyt-275     Hystemcell.cn  Recombinant Mouse Stem Cell Factor

rSCF cyt-323     Hystemcell.cn  Recombinant Rat Stem Cell Factor

SCF Sf9     cyt-421     Hystemcell.cn  Recombinant Human Stem Cell Factor, Sf9

SCF HEK   cyt-111     Hystemcell.cn  Recombinant Human Stem Cell Factor, HEK

k9SCF        cyt-194     Hystemcell.cn  Recombinant Canine Stem Cell Factor

SF20 cyt-622     Hystemcell.cn  Recombinant Human Chromosome 19 Open Reading Frame 10

mSF20      cyt-678     Hystemcell.cn  Recombinant Mouse Chromosome 19 Open Reading Frame 10

SPP1          cyt-635     Hystemcell.cn  Recombinant Human Osteopontin

SPP1 HEK cyt-047     Hystemcell.cn  Recombinant Human Osteopontin, HEK

TACI         cyt-032     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor Receptor 13B

TAFA2       cyt-118     Hystemcell.cn  Recombinant Human Family with Sequence Similarity 19 Member A2

TDGF1      cyt-712     Hystemcell.cn  Recombinant Human Teratocarcinoma-Derived Growth Factor 1

TFF1 cyt-586     Hystemcell.cn  Recombinant Human Trefoil Factor-1

TFF1 His   cyt-610     Hystemcell.cn  Recombinant Human Trefoil Factor-1 His Tag

TFF2         cyt-612     Hystemcell.cn  Recombinant Human Trefoil Factor-2

TFF2 His   cyt-611     Hystemcell.cn  Recombinant Human Trefoil Factor-2 His Tag

TFF3         cyt-005     Hystemcell.cn  Recombinant Human Trefoil Factor-3

TFF3 His   cyt-616     Hystemcell.cn  Recombinant Human Trefoil Factor-3 His Tag

TGF b 1   cyt-716     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 1

TGF b 1     cyt-561     Human Transforming Growth Factor-Beta 1

TGF b 1 GST      cyt-473     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 1, GST tag

TGF b 1 His       cyt-672     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 1 His Tag

TGF b 1 (113 a.a.)    cyt-679     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.)

TGF b 2     cyt-441     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 2

TGF b 2 HEK     cyt-112     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 2, HEK

TGF b 3     cyt-368     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 3

TGF b 3 CHO    cyt-685     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 3, CHO

TGF b 3 Plant   cyt-588     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 3, Plant

TGF b 3 HEK     cyt-113     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 3, HEK

TGF b 3 (207 a.a.)    cyt-319     Hystemcell.cn  Recombinant Human Transforming Growth Factor-Beta 3 (644-850)

mTGF b 3 cyt-143     Hystemcell.cn  Recombinant Mouse Transforming Growth Factor-Beta 3

4 1BBR     cyt-463     Hystemcell.cn  Recombinant Human 4-1BB Receptor

4 1BBR, His      cyt-137     Hystemcell.cn  Recombinant Human 4-1BB Receptor His Tag

4 1BBL      cyt-149     Hystemcell.cn  Recombinant Human 4-1BB Ligand

4 1BBL, His       cyt-649     Hystemcell.cn  Recombinant Human 4-1BB Ligand, His Tag

TNF a       cyt-223     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor-alpha

TNF a His cyt-494     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor-alpha, His Tag

TNF a HEK         cyt-114     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor-alpha, HEK

mTNF a    cyt-252     Hystemcell.cn  Recombinant Mouse Tumor Necrosis Factor-alpha

rTNF a      cyt-393     Hystemcell.cn  Recombinant Rat Tumor Necrosis Factor-alpha

rpTNF a    cyt-405     Hystemcell.cn  Recombinant Porcine Tumor Necrosis Factor-alpha

raTNF a    cyt-008     Hystemcell.cn  Recombinant Rabbit Tumor Necrosis Factor-alpha

rCaTNF a cyt-140     Hystemcell.cn  Recombinant Canine Tumor Necrosis Factor-alpha

rmTNF a   cyt-737     Hystemcell.cn  Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha

TNF a Mutant  cyt-384     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor-alpha, Mutant

TNF b        cyt-224     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor-beta

TNF b His cyt-495     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor-beta, His Tag

TNFR2      cyt-674     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor Receptor Type 2

TNFR2 Fc cyt-422     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein

TNFRSF17         cyt-598     Hystemcell.cn  Recombinant Human B-Cell Maturation Antigen

TNFRSF17, His cyt-190     Hystemcell.cn  Recombinant Human B-Cell Maturation Antigen, His Tag

TNFR         cyt-707     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor Receptor

TNFR His  cyt-673     Hystemcell.cn  Recombinant Human Tumor Necrosis Factor Receptor Type His Tag

TNFSF12   cyt-699     Hystemcell.cn  Recombinant Human TNF Ligand Superfamily Member 12

TNFRSF10B       cyt-069     Hystemcell.cn  Recombinant Human TNF Ligand Receptor Superfamily Member 10B

TNFRSF12A       cyt-043     Hystemcell.cn  Recombinant Human TNF Ligand Receptor Superfamily Member 12A

TSLP cyt-572     Hystemcell.cn  Recombinant Human Thymic Stromal Lymphopoietin

TSLPR       cyt-742     Hystemcell.cn  Recombinant Human Thymic Stromal Lymphopoietin Receptor

TPO  cyt-302     Hystemcell.cn  Recombinant Human Thrombopoietin

TPO CHO cyt-462     Hystemcell.cn  Recombinant Human Thrombopoietin, CHO

TPO HEK  cyt-115     Hystemcell.cn  Recombinant Human Thrombopoietin, HEK

mTPO       cyt-346     Hystemcell.cn  Recombinant Mouse Thrombopoietin

TRAIL        cyt-443     Hystemcell.cn  Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L

TRAIL (114-281 a.a.)        cyt-546     Hystemcell.cn  Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281)

ULBP1      cyt-166     Hystemcell.cn  Recombinant Human UL16 Binding Protein 1

Vaspin      cyt-459     Hystemcell.cn  Recombinant Human Vaspin

VEGF         cyt-241     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor

VEGF His  cyt-496     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor, His Tag

VEGF CHO        cyt-260     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor, CHO

VEGF HEK         cyt-225     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor, HEK

VEGF Yeast       cyt-577     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor, Yeast

VEGF (121a.a.)         cyt-343     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor (121)

VEGF (121a.a.) Sf9   cyt-200     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor (121), Sf9

VEGF (121a.a.) His  cyt-619     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor (121), His Tag

VEGF (121a.a.) HEK cyt-116     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor (121), HEK

rmVEGF   cyt-336     Hystemcell.cn  Recombinant Mouse Vascular Endothelial Growth Factor

mVEGF Sf9        cyt-226     Hystemcell.cn  Recombinant Mouse Vascular Endothelial Growth Factor-Sf9

rmVEGF (121a.a.)    cyt-574     Hystemcell.cn  Recombinant Mouse Vascular Endothelial Growth Factor (121)

rmVEGF His      cyt-680     Hystemcell.cn  Recombinant Mouse Vascular Endothelial Growth Factor, His Tag

rVEGF       cyt-392     Hystemcell.cn  Recombinant Rat Vascular Endothelial Growth Factor

VEGFB      cyt-628     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor B

VEGF C     cyt-527     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor Related Protein

rVEGF C   cyt-262     Hystemcell.cn  Recombinant Rat Vascular Endothelial Growth Factor Related Protein

rVEGF C (152a.a.)    cyt-284     Hystemcell.cn  Recombinant Rat Vascular Endothelial Growth Factor-C (152)

VEGF D     cyt-045     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Factor D

VEGF E (Orf Virus)    cyt-263     Hystemcell.cn  Recombinant Vascular Endothelial Growth Factor-E (Orf Virus)

VEGI         cyt-517     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Inhibitor

VEGI His  cyt-589     Hystemcell.cn  Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag

Visfatin    cyt-318     Hystemcell.cn  Recombinant Human Visfatin

Visfatin His       cyt-563     Hystemcell.cn  Recombinant Human Visfatin, His Tag

mVisfatin cyt-447     Hystemcell.cn  Recombinant Mouse Visfatin

重慶市華雅干細(xì)胞技術(shù)有限公司   

 


產(chǎn)品咨詢

留言框

  • 產(chǎn)品:

  • 您的單位:

  • 您的姓名:

  • 聯(lián)系電話:

  • 常用郵箱:

  • 省份:

  • 詳細(xì)地址:

  • 補(bǔ)充說明:

  • 驗(yàn)證碼:

    請輸入計(jì)算結(jié)果(填寫阿拉伯?dāng)?shù)字),如:三加四=7
推薦產(chǎn)品

2024 版權(quán)所有 © 重慶市華雅干細(xì)胞技術(shù)有限公司  備案號(hào):渝ICP備14000349號(hào)-4 sitemap.xml 管理登陸 技術(shù)支持:化工儀器網(wǎng)

地址:重慶市江北區(qū)金渝大道153號(hào)8棟20-14 傳真:023-63419626 郵件:sales@ys-bio.com

重慶市華雅干細(xì)胞技術(shù)有限公司主要經(jīng)營干細(xì)胞研究 干細(xì)胞治療產(chǎn)品 生物試劑 實(shí)驗(yàn)耗材 藥物研發(fā)等產(chǎn)品。

關(guān)注我們

服務(wù)熱線

400-021-2200

掃一掃,關(guān)注我們